Structure of PDB 6npw Chain D Binding Site BS01

Receptor Information
>6npw Chain D (length=192) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKP
NVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTK
EQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGA
FVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Ligand information
>6npw Chain E (length=5) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTSPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6npw Structural determinants for accurate dephosphorylation of RNA polymerase II by its cognate C-terminal domain (CTD) phosphatase during eukaryotic transcription.
Resolution2.486 Å
Binding residue
(original residue number in PDB)		D13 S14 S15 M17 N18 R19 K44 P46 N144
Binding residue
(residue number reindexed from 1)		D10 S11 S12 M14 N15 R16 K41 P43 N141
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0031124 mRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6npw, PDBe:6npw, PDBj:6npw
PDBsum6npw
PubMed30971428
UniProtQ9VWE4

[Back to BioLiP]