Structure of PDB 6nnv Chain D Binding Site BS01

Receptor Information
>6nnv Chain D (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVELDLAALIVYWEMEDKNIIQFVH
GEEDLKTQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYG
GADYKRITVKVNAPYAAALHE
Ligand information
>6nnv Chain J (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FFKGDVFYGWYLCK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nnv Fragment-based screening of programmed death ligand 1 (PD-L1).
Resolution1.92 Å
Binding residue
(original residue number in PDB)		T37 E39 L88 Q91 Q100
Binding residue
(residue number reindexed from 1)		T20 E22 L69 Q72 Q81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6nnv, PDBe:6nnv, PDBj:6nnv
PDBsum6nnv
PubMed30728114
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]