Structure of PDB 6nju Chain D Binding Site BS01

Receptor Information

>6nju Chain D (length=229) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSA
CDFREDDSVHAYHRATNADYRGSGFDRGALAAAANHRWSQRAMDDTFYLS
NVAPQVPHLNQNAWNNLERYSRSLTRTYQNVYVCTGPLFLPRTEADGKSY
VKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRSYVMPNAPVDETIPLER
FLVPIESIERASGLLFVPNILARAGNLKA

Ligand information

>6nju Chain E (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggcgccgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6nju Structural adaptation of vertebrate endonuclease G for 5-hydroxymethylcytosine recognition and function.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	D75 S76
Binding residue (residue number reindexed from 1)	D57 S58

Enzymatic activity

Enzyme Commision number

3.1.30.-

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6nju, PDBe:6nju, PDBj:6nju
PDBsum	6nju
PubMed	32095813
UniProt	O08600\|NUCG_MOUSE Endonuclease G, mitochondrial (Gene Name=Endog)

[Back to BioLiP]