Structure of PDB 6n7v Chain D Binding Site BS01

Receptor Information

>6n7v Chain D (length=271) Species: 10760 (Escherichia phage T7)

DGVVSALSLRERIREHLSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGM
GKSTFVRQQALQWGTAMGKKVGLAMLQESVEETAEDLIGLHNRVRLRQSD
SLKREIIENGKFDQWFDELFGNDTFHLYDSTDRLLAKLAYMRSGLGCDVI
ILDHISIVVSRKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEG
RPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTG
IAGYMEYNKETGWLEPSSYSG

Ligand information

>6n7v Chain T (length=16)

tttttttttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6n7v Structures and operating principles of the replisome.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): R439 K467 N468 R487 G488 S489 G490
• Binding residue (residue number reindexed from 1): R161 K189 N190 R209 G210 S211 G212

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  3.6.4.12: DNA helicase.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0003697 single-stranded DNA binding
• GO:0003896 DNA primase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0043139 5'-3' DNA helicase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006269 DNA replication, synthesis of primer
• GO:0032508 DNA duplex unwinding
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:1990077 primosome complex

External links

• PDB: RCSB:6n7v, PDBe:6n7v, PDBj:6n7v
• PDBsum: 6n7v
• PubMed: 30679383
• UniProt: P03692|HELIC_BPT7 DNA helicase/primase (Gene Name=4)