Structure of PDB 6mpz Chain D Binding Site BS01

Receptor Information
>6mpz Chain D (length=141) Species: 1410622 (Lachnospiraceae bacterium C6A11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQPVTRGRAKVPVIMQMEALECGAASLAMVLAYYKKWVPLEQVRVDCGV
SRDGSNALNVLKAARNYGLEAKGYRYEPEKLKKEGTFPCIIHWNFNHFVV
LKGFKGKYAYINDPAKGDVKIPMEEFDRSFTGICLIFKPTD
Ligand information
>6mpz Chain P (length=14) Species: 74547 (Prochlorococcus marinus str. MIT 9313) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GNLSDDELEGVAGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mpz Insights into AMS/PCAT transporters from biochemical and structural characterization of a double Glycine motif protease.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		A24 C27 G58 S59 N60 A61 L62 G77 Y78 R79 H96 N100 H101 F102
Binding residue
(residue number reindexed from 1)		A20 C23 G54 S55 N56 A57 L58 G73 Y74 R75 H92 N96 H97 F98
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 17:16:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6mpz', asym_id = 'D', bs = 'BS01', title = 'Insights into AMS/PCAT transporters from biochem...racterization of a double Glycine motif protease.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6mpz', asym_id='D', bs='BS01', title='Insights into AMS/PCAT transporters from biochem...racterization of a double Glycine motif protease.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0005524,0006508,0008233,0016020', uniprot = '', pdbid = '6mpz', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0006508,0008233,0016020', uniprot='', pdbid='6mpz', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>