Structure of PDB 6m4d Chain D Binding Site BS01

Receptor Information

>6m4d Chain D (length=93) Species: 9606 (Homo sapiens)

RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Ligand information

>6m4d Chain I (length=125)

cggtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaa
cgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactccc
tagtctccaggcacgtgtcagatat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6m4d Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
• Resolution: 4.4 Å
• Binding residue (original residue number in PDB): I39 Y40
• Binding residue (residue number reindexed from 1): I7 Y8

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0006334 nucleosome assembly
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0000786 nucleosome
• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6m4d, PDBe:6m4d, PDBj:6m4d
• PDBsum: 6m4d
• PubMed: 33073403
• UniProt: Q16778|H2B2E_HUMAN Histone H2B type 2-E (Gene Name=H2BC21)