Structure of PDB 6lwq Chain D Binding Site BS01

Receptor Information
>6lwq Chain D (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASA
RGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRF
YTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQEYQQFRENVLRN
LADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEAL
QNPDLLELCHSVPKEVVQLEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW
FQGDPGPLAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lwq DNA repair glycosylase hNEIL1 triages damaged bases via competing interaction modes.
Resolution2.89 Å
Binding residue
(original residue number in PDB)
P2 E3 K54 R78 G80 M81 R118 F120 Q168 N176 Y263 R277 T278
Binding residue
(residue number reindexed from 1)
P1 E2 K53 R77 G79 M80 R117 F119 Q167 N175 Y233 R247 T248
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008270 zinc ion binding
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0019104 DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6lwq, PDBe:6lwq, PDBj:6lwq
PDBsum6lwq
PubMed34226550
UniProtQ96FI4|NEIL1_HUMAN Endonuclease 8-like 1 (Gene Name=NEIL1)

[Back to BioLiP]