Structure of PDB 6lwj Chain D Binding Site BS01

Receptor Information
>6lwj Chain D (length=265) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASA
RGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRF
YTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQEYQQFRENVLRN
LADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEAL
QPDLLELCHSVPKEVVQLGGKGYGEEDFAAFRAWLRCYGMPGMSSLQDRH
GRTIWFQGDPGPLAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lwj DNA repair glycosylase hNEIL1 triages damaged bases via competing interaction modes.
Resolution2.83 Å
Binding residue
(original residue number in PDB)		G2 Q3 E6 K54 R78 M81 R118 F120 R133 Q168 N176 K242 Y263 R277
Binding residue
(residue number reindexed from 1)		G1 Q2 E5 K53 R77 M80 R117 F119 R132 Q167 N175 K221 Y238 R252
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008270 zinc ion binding
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0019104 DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lwj, PDBe:6lwj, PDBj:6lwj
PDBsum6lwj
PubMed34226550
UniProtQ96FI4|NEIL1_HUMAN Endonuclease 8-like 1 (Gene Name=NEIL1)

[Back to BioLiP]