Structure of PDB 6las Chain D Binding Site BS01

Receptor Information
>6las Chain D (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Ligand information
>6las Chain A (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcauugugccucgcauugcacuccgcggggcgauaaguccugaaaaggg
auguc
<<<<<<.<<<<<<<<..........>>>>>>>>......<<<....>>>>
>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6las SAM-VI riboswitch structure and signature for ligand discrimination.
Resolution2.708 Å
Binding residue
(original residue number in PDB)		Y13 K23 K46 R47 K50 R52 F56 Q85 K88 D92
Binding residue
(residue number reindexed from 1)		Y7 K17 K40 R41 K44 R46 F50 Q79 K82 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6las, PDBe:6las, PDBj:6las
PDBsum6las
PubMed31844059
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]