Structure of PDB 6ke9 Chain D Binding Site BS01

Receptor Information
>6ke9 Chain D (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6ke9 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttagggttagggttagggttagggttagggttagggttagggttagg
gttagggttagggttagggttagggttagggttagggttagggttagggt
tagggttagggttagggttagggttagggttagggttagggtgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ke9 The human telomeric nucleosome displays distinct structural and dynamic properties.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		R28 S29 R30 Y39 G50 I51 S53 S84 T85
Binding residue
(residue number reindexed from 1)		R1 S2 R3 Y12 G23 I24 S26 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6ke9, PDBe:6ke9, PDBj:6ke9
PDBsum6ke9
PubMed
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]