Structure of PDB 6jxd Chain D Binding Site BS01

Receptor Information
>6jxd Chain D (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6jxd Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
catatatcccggtgccgaggccgctcaattggtcgtagacagctctagca
ccgcttaaacgcacgtacgcgctgtctaccgcgttttaaccgccactaga
agcgcttactagtctccaggcacgtgtgagaccggcatatatggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxd PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		S29 Y39 I51 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		S4 Y14 I26 S28 R58 S59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jxd, PDBe:6jxd, PDBj:6jxd
PDBsum6jxd
PubMed31848352
UniProtP06899|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)

[Back to BioLiP]