Structure of PDB 6jrp Chain D Binding Site BS01

Receptor Information
>6jrp Chain D (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQK
YHDLAFQVKEAHFKAHPDWKWCNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jrp The crystal structure of Capicua HMG-box domain complexed with the ETV5-DNA and its implications for Capicua-mediated cancers.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N205 F207 M208 R228 S231 W238 K257 W269
Binding residue
(residue number reindexed from 1)		N7 F9 M10 R30 S33 W40 K59 W71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jrp, PDBe:6jrp, PDBj:6jrp
PDBsum6jrp
PubMed31323153
UniProtQ96RK0|CIC_HUMAN Protein capicua homolog (Gene Name=CIC)

[Back to BioLiP]