Structure of PDB 6jpi Chain D Binding Site BS01

Receptor Information
>6jpi Chain D (length=93) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADM
AIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jpi Crystal structure of PA4674 in complex with its operator DNA (28bp) from Pseudomonas aeruginosa
Resolution3.143 Å
Binding residue
(original residue number in PDB)
P27 A28 R32 N42 R46
Binding residue
(residue number reindexed from 1)
P22 A23 R27 N37 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6jpi, PDBe:6jpi, PDBj:6jpi
PDBsum6jpi
PubMed
UniProtQ9HVC1

[Back to BioLiP]