Structure of PDB 6jma Chain D Binding Site BS01

Receptor Information
>6jma Chain D (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6jma Chain I (length=114) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agattctaccaaaagtgtatttggaaactgctccatcaaaaggcatgttc
agctgaattcagctgaacatgccttttgatggagcagtttccaaatacac
ttttggtagaatct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jma Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
Resolution6.8 Å
Binding residue
(original residue number in PDB)
T29 R30 I51 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
T1 R2 I23 S24 S25 R55 S56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6jma, PDBe:6jma, PDBj:6jma
PDBsum6jma
PubMed30923167
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]