Structure of PDB 6j9h Chain D Binding Site BS01

Receptor Information
>6j9h Chain D (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPV
PERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIK
CLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGAL
GMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPH
SVEQIEWKHSVLDVERLGRDDFRKELERHARDMRL
Ligand information
>6j9h Chain C (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSAQQELKQRQRAEIYALNRVMTELE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9h Molecular basis of vasohibins-mediated detyrosination and its impact on spindle function and mitosis.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		M69 W74 I84 H85 I95 R96 L101 I104 P105 L132 Q133 Y134 H136 T137 F141 E163 A164 L165 P166
Binding residue
(residue number reindexed from 1)		M1 W6 I16 H17 I27 R28 L33 I36 P37 L64 Q65 Y66 H68 T69 F73 E95 A96 L97 P98
Enzymatic activity
Enzyme Commision number 3.4.17.17: tubulinyl-Tyr carboxypeptidase.
Gene Ontology
Biological Process
GO:0045765 regulation of angiogenesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j9h, PDBe:6j9h, PDBj:6j9h
PDBsum6j9h
PubMed31171830
UniProtQ7L8A9|VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 (Gene Name=VASH1)

[Back to BioLiP]