Structure of PDB 6j9c Chain D Binding Site BS01

Receptor Information
>6j9c Chain D (length=112) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STFDNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVVQ
MRDVFSMQSWSFKYKFWSNNKSRMYVLENTGEFVKQNGAEIGDFLTIYED
ESKNLYFAMNGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9c Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis.
Resolution3.102 Å
Binding residue
(original residue number in PDB)		R185 K203 K224 W226 S227 N228
Binding residue
(residue number reindexed from 1)		R26 K44 K65 W67 S68 N69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:6j9c, PDBe:6j9c, PDBj:6j9c
PDBsum6j9c
PubMed30962525
UniProtQ1PFR7|LEC2_ARATH B3 domain-containing transcription factor LEC2 (Gene Name=LEC2)

[Back to BioLiP]