Structure of PDB 6j2p Chain D Binding Site BS01

Receptor Information
>6j2p Chain D (length=92) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYC
QAGITGKEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGR
Ligand information
>6j2p Chain G (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2p Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		Y24 G33 L35 M36 D43 W45 V61 F62
Binding residue
(residue number reindexed from 1)		Y5 G14 L16 M17 D24 W26 V42 F43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:6j2p, PDBe:6j2p, PDBj:6j2p
PDBsum6j2p
PubMed31253666
UniProtQ03012|SPP1_YEAST COMPASS component SPP1 (Gene Name=SPP1)

[Back to BioLiP]