Structure of PDB 6j2i Chain D Binding Site BS01

Receptor Information
>6j2i Chain D (length=280) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHGFHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEP
RAPWMDLVEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHT
IQRMYGCDVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTR
RKWEEAGYAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPI
SDREVTLRCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKW
AALVVPSGEEQRYTCHVQHEGLPQPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2i Peptide presentation by bat MHC class I provides new insight into the antiviral immunity of bats.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y7 Y62 R65 N66 N69 T76 G80 Y87 R100 T146 K149 W150 A153 Y155 R158 D159 Y162 W170
Binding residue
(residue number reindexed from 1)
Y10 Y65 R68 N69 N72 T79 G83 Y90 R103 T149 K152 W153 A156 Y158 R161 D162 Y165 W173
Enzymatic activity
Enzyme Commision number ?
External links