Structure of PDB 6j2f Chain D Binding Site BS01

Receptor Information
>6j2f Chain D (length=277) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEPRAP
WMDLVEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHTIQR
MYGCDVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTRRKW
EEAGYAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPISDR
EVTLRCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKWAAL
VVPSGEEQRYTCHVQHEGLPQPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2f Peptide presentation by bat MHC class I provides new insight into the antiviral immunity of bats.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 Y9 A24 F36 Y62 R65 N66 N69 A73 T76 N83 Y87 R100 Y102 T146 K149 W150 Y155 R158 Y162 W170
Binding residue
(residue number reindexed from 1)		Y7 Y9 A24 F36 Y62 R65 N66 N69 A73 T76 N83 Y87 R100 Y102 T146 K149 W150 Y155 R158 Y162 W170
Enzymatic activity
Enzyme Commision number ?
External links