Structure of PDB 6irq Chain D Binding Site BS01

Receptor Information
>6irq Chain D (length=103) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESQERTEWHRVVFF
GRLAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIVVDINGNMQ
LLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6irq Characterization of an SSB-dT25 complex: structural insights into the S-shaped ssDNA binding conformation.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		R62 I66 Y70 N106 M109 Q110 L111
Binding residue
(residue number reindexed from 1)		R52 I56 Y60 N96 M99 Q100 L101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6irq, PDBe:6irq, PDBj:6irq
PDBsum6irq
PubMed
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]