Structure of PDB 6i2n Chain D Binding Site BS01

Receptor Information
>6i2n Chain D (length=336) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPTGVEPGDHLKERSMLSYGNVLDLNHLDIDEPTGQTADWLSIIVYLTSF
VVPILLKALYMLTTRGRQTTKDNKGTRIRFKDDSSFEDVNGIRKPKHLYV
SLPNAQSSMKAEEITPGRYRTAVCGLYPAQIKARQMISPVMSVIGFLALA
KDWSDRIEQWLIEPCKATNRDYLRQRQVALGNMETKESKAIRQHAEAAGC
SMIEDIESPSSIWVFAGAPDRCPPTCLFIAGIAELGAFFSILQDMRNTIM
ASKTVGTSEEKLRKKSSFYQSYLRRTQSMGIQLGQRIIVLFMVAWGKEAV
DNFHLGDDMDPELRTLAQSLIDVKVKEISNQEPLKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i2n High resolution cryo-EM structure of the helical RNA-bound Hantaan virus nucleocapsid reveals its assembly mechanisms.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		P182 R197 S359 F361 S364 R368
Binding residue
(residue number reindexed from 1)		P103 R118 S266 F268 S271 R275
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0052150 symbiont-mediated perturbation of host apoptosis
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:0044177 host cell Golgi apparatus
GO:0044220 host cell perinuclear region of cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i2n, PDBe:6i2n, PDBj:6i2n
PDBsum6i2n
PubMed30638449
UniProtP05133|NCAP_HANTV Nucleoprotein (Gene Name=N)

[Back to BioLiP]