Structure of PDB 6hwn Chain D Binding Site BS01

Receptor Information
>6hwn Chain D (length=187) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIPYVIRVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQE
IKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEK
GRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTG
QPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hwn Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		G68 E69 V70 S97 M98 P124 W125
Binding residue
(residue number reindexed from 1)		G60 E61 V62 S89 M90 P116 W117
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hwn, PDBe:6hwn, PDBj:6hwn
PDBsum6hwn
PubMed31517045
UniProtQ5SKM8|CLPP_THET8 ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]