Structure of PDB 6hu4 Chain D Binding Site BS01

Receptor Information
>6hu4 Chain D (length=149) Species: 10407 (Hepatitis B virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKLRQL
LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hu4 Structure of Mutant Hepatitis B Core Protein Capsids with Premature Secretion Phenotype.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		A41 C48
Binding residue
(residue number reindexed from 1)		A41 C48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075521 microtubule-dependent intracellular transport of viral material towards nucleus
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0030430 host cell cytoplasm
GO:0039619 T=4 icosahedral viral capsid
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hu4, PDBe:6hu4, PDBj:6hu4
PDBsum6hu4
PubMed30539760
UniProtP03146|CAPSD_HBVD3 Capsid protein (Gene Name=C)

[Back to BioLiP]