Structure of PDB 6ht5 Chain D Binding Site BS01

Receptor Information
>6ht5 Chain D (length=77) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKR
PFIDEAKRLRALHMKEHPDYKYRPRRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ht5 Oct4/Sox2:UTF1 structure
Resolution3.451 Å
Binding residue
(original residue number in PDB)
R48 N51 F53 S74 S77 K78 K114 Y115
Binding residue
(residue number reindexed from 1)
R5 N8 F10 S31 S34 K35 K71 Y72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ht5, PDBe:6ht5, PDBj:6ht5
PDBsum6ht5
PubMed
UniProtP48432|SOX2_MOUSE Transcription factor SOX-2 (Gene Name=Sox2)

[Back to BioLiP]