Structure of PDB 6hc0 Chain D Binding Site BS01

Receptor Information
>6hc0 Chain D (length=102) Species: 264462 (Bdellovibrio bacteriovorus HD100) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPPAIVVLIGPPGYVGKQYPITASDIVIGRSVESQVYIDDKSLSRSHAKF
AVNGSEVSVIDLGSTNKTIVNGQVIPPLASCLLKNNDQIKTGNVIFKFLE
KG
Ligand information
>6hc0 Chain A (length=7) Species: 264462 (Bdellovibrio bacteriovorus HD100) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTSIVAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hc0 Structural basis for activation of a diguanylate cyclase required for bacterial predation in Bdellovibrio.
Resolution1.87 Å
Binding residue
(original residue number in PDB)		R61 K72 N97 N124
Binding residue
(residue number reindexed from 1)		R30 K41 N66 N93
Enzymatic activity
Enzyme Commision number ?
External links