Structure of PDB 6h9c Chain D Binding Site BS01

Receptor Information
>6h9c Chain D (length=174) Species: 662475 (Haloarcula californiae ATCC 33799) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIGNLSAEKQISLYDGQPFISEQDVAAGDPNTPALTIEGPDGYVIAVDAG
TPIAPEFRDSNGEKLDPSTRVIVQKCDRQGNPLGDGIIFNDTLGRFNYNK
MRTDPDYMRKTAKSLMVDEREIVKVFVDVPDGANGYDAERSRFTLGDDTS
DFGKAVEIVDHDDLTEGETQAVKS
Ligand information
>6h9c Chain f (length=18) Species: 662475 (Haloarcula californiae ATCC 33799) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h9c Structural basis for assembly of vertical single beta-barrel viruses.
Resolution3.74 Å
Binding residue
(original residue number in PDB)		M118 E159 E168 K175
Binding residue
(residue number reindexed from 1)		M116 E157 E166 K173
Enzymatic activity
Enzyme Commision number ?
External links