Structure of PDB 6h6h Chain D Binding Site BS01

Receptor Information
>6h6h Chain D (length=273) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYQQYAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNLRTDSPKAHVTHHPRSKGEVTLRC
WALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGK
EQNYTCRVYHEGLPEPLTLRWEP
Ligand information
>6h6h Chain F (length=10) Species: 10535 (unidentified adenovirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGPSNTPPEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h6h Crystal structures of H-2Db and H-2Dbm13 with cancer-associated Ad 10 peptide reveal that subtle changes in the peptide environment impact thermostability and alloreactivity
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 Y123 T143 W147 S150 H155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 Y123 T143 W147 S150 H155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h6h, PDBe:6h6h, PDBj:6h6h
PDBsum6h6h
PubMed
UniProtQ31167

[Back to BioLiP]