Structure of PDB 6h6a Chain D Binding Site BS01

Receptor Information
>6h6a Chain D (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP
KDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQ
LLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFY
FVDDRLVMHNKADYSYSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h6a The Ciliary Machinery Is Repurposed for T Cell Immune Synapse Trafficking of LCK.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F88 F91 A125 G126 R127 F128 S218 Y220 N230
Binding residue
(residue number reindexed from 1)
F30 F33 A55 G56 R57 F58 S148 Y150 N160
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6h6a, PDBe:6h6a, PDBj:6h6a
PDBsum6h6a
PubMed30220567
UniProtQ13432|U119A_HUMAN Protein unc-119 homolog A (Gene Name=UNC119)

[Back to BioLiP]