Structure of PDB 6h06 Chain D Binding Site BS01

Receptor Information

>6h06 Chain D (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVVMTQSPLSLPVTPGEPASISCRSSQSLLHRSGHKYLHWYLQRPGQSPQ
VLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGLYYCMQTLQTP
WTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRG

Ligand information

>6h06 Chain G (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VDSPQLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6h06 Enhancement of therapeutic potential of a naturally occurring human antibody targeting a phosphorylated Ser422containing epitope on pathological tau.
Resolution	2.63 Å
Binding residue (original residue number in PDB)	H31 Y37 L97 Q98 T99
Binding residue (residue number reindexed from 1)	H31 Y37 L97 Q98 T99

External links

PDB	RCSB:6h06, PDBe:6h06, PDBj:6h06
PDBsum	6h06
PubMed	30001207

[Back to BioLiP]