Structure of PDB 6gc5 Chain D Binding Site BS01

Receptor Information
>6gc5 Chain D (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFCKGFGFVTMTNY
EEAAMAIASLNGYRLGDKILQVSFKTN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gc5 Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F247 Y249 I276 F289 Q316 K320 T321
Binding residue
(residue number reindexed from 1)		F6 Y8 I35 F44 Q71 K75 T76
Binding affinityPDBbind-CN: Kd=0.65uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6gc5, PDBe:6gc5, PDBj:6gc5
PDBsum6gc5
PubMed30718402
UniProtQ15717|ELAV1_HUMAN ELAV-like protein 1 (Gene Name=ELAVL1)

[Back to BioLiP]