Structure of PDB 6fms Chain D Binding Site BS01

Receptor Information

>6fms Chain D (length=149) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTLAYNTGAAFS
FLADSSGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGAL
GNLYDRMVLGHVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALDMFR

Ligand information

>6fms Chain H (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LIST

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6fms In situ serial crystallography for rapid de novo membrane protein structure determination.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	N54 A57 N112 R116 V122 D124 D143 I146
Binding residue (residue number reindexed from 1)	N44 A47 N102 R106 V112 D114 D133 I136

Enzymatic activity

Enzyme Commision number

3.4.23.36: signal peptidase II.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006465	signal peptide processing
GO:0006508	proteolysis

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fms, PDBe:6fms, PDBj:6fms
PDBsum	6fms
PubMed	30272004
UniProt	Q9HVM5\|LSPA_PSEAE Lipoprotein signal peptidase (Gene Name=lspA)

[Back to BioLiP]