Structure of PDB 6dmx Chain D Binding Site BS01

Receptor Information
>6dmx Chain D (length=81) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMY
ESANSRDEYYHLLAEKIYKIQKELEEKRRSR
Ligand information
>6dmx Chain C (length=25) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPEKEKRIKELELLLMSTENELKGQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dmx Structural basis for cooperative regulation of KIX-mediated transcription pathways by the HTLV-1 HBZ activation domain.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D598 H602 L603 K606 R646 Y650 H651 A654 E655 I657 Y658 Q661
Binding residue
(residue number reindexed from 1)		D8 H12 L13 K16 R56 Y60 H61 A64 E65 I67 Y68 Q71
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6dmx, PDBe:6dmx, PDBj:6dmx
PDBsum6dmx
PubMed30232260
UniProtP45481|CBP_MOUSE Histone lysine acetyltransferase CREBBP (Gene Name=Crebbp)

[Back to BioLiP]