Structure of PDB 6dm4 Chain D Binding Site BS01

Receptor Information
>6dm4 Chain D (length=119) Species: 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDT
ENKYVFIAASFQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGV
MATLTQHITQNKELIEKAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dm4 Crystal structure of the SH2 domain from RavO (Lpg1129) from Legionella pneumophila in complex with Homo sapiens Shc1 phospho-Tyr317 peptide
Resolution1.9 Å
Binding residue
(original residue number in PDB)
R266 S268 S269 H293 S294 R296 N309 T310 T316
Binding residue
(residue number reindexed from 1)
R41 S43 S44 H68 S69 R71 N84 T85 T91
Enzymatic activity
Enzyme Commision number ?
External links