Structure of PDB 6dkp Chain D Binding Site BS01

Receptor Information
>6dkp Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQNSGPLSVPEGAIASLNCTYSYRGSQSFFWYRQYSGKSPELIMFIA
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFG
QGTELSVKPNIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDVYITD
KCVLDMRSMDFKSNSAVAWSNKSDFACANNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dkp Improving T Cell Receptor On-Target Specificity via Structure-Guided Design.
Resolution2.966 Å
Binding residue
(original residue number in PDB)
G28 Q30
Binding residue
(residue number reindexed from 1)
G28 Q30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6dkp, PDBe:6dkp, PDBj:6dkp
PDBsum6dkp
PubMed30617019
UniProtA0A075B6T6|TVAL2_HUMAN T cell receptor alpha variable 12-2 (Gene Name=TRAV12-2);
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]