Structure of PDB 6dkp Chain D Binding Site BS01

Receptor Information

>6dkp Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KEVEQNSGPLSVPEGAIASLNCTYSYRGSQSFFWYRQYSGKSPELIMFIA
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFG
QGTELSVKPNIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDVYITD
KCVLDMRSMDFKSNSAVAWSNKSDFACANNNSIIPEDTFFPS

Ligand information

>6dkp Chain C (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELAGIGILTV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6dkp Improving T Cell Receptor On-Target Specificity via Structure-Guided Design.
Resolution	2.966 Å
Binding residue (original residue number in PDB)	G28 Q30
Binding residue (residue number reindexed from 1)	G28 Q30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042605	peptide antigen binding

	Biological Process
GO:0002250	adaptive immune response

	Cellular Component
GO:0005886	plasma membrane
GO:0042101	T cell receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dkp, PDBe:6dkp, PDBj:6dkp
PDBsum	6dkp
PubMed	30617019
UniProt	A0A075B6T6\|TVAL2_HUMAN T cell receptor alpha variable 12-2 (Gene Name=TRAV12-2); P01848\|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]