Structure of PDB 6cl2 Chain D Binding Site BS01

Receptor Information
>6cl2 Chain D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQI
LTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cl2 Selective and Rapid Cell-Permeable Inhibitor of Human Caspase-3.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
Y230 S231 W232 R233 S234 P235 S275 Q276 D278 F282
Binding residue
(residue number reindexed from 1)
Y19 S20 W21 R22 S23 P24 S64 Q65 D67 F71
Enzymatic activity
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6cl2, PDBe:6cl2, PDBj:6cl2
PDBsum6cl2
PubMed31334631
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]