Structure of PDB 6chv Chain D Binding Site BS01

Receptor Information
>6chv Chain D (length=91) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSI
RIAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYGESN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6chv Structural basis of transcriptional regulation by the HigA antitoxin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V33 T34 A36 T37 R40 T46 T49 L52
Binding residue
(residue number reindexed from 1)		V29 T30 A32 T33 R36 T42 T45 L48
Binding affinityPDBbind-CN: Kd=125nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6chv, PDBe:6chv, PDBj:6chv
PDBsum6chv
PubMed30793388
UniProtQ7A224|HIGA_PROVU Antitoxin HigA (Gene Name=higA)

[Back to BioLiP]