Structure of PDB 6cdm Chain D Binding Site BS01

Receptor Information
>6cdm Chain D (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPVHGLEWIGA
IVPETGFTAYTQKFKGKAMLTADKSSSTAYMELRSLTSEDSAVYFCSRLR
LYWYFDVWGTGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEP
Ligand information
>6cdm Chain F (length=6) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cdm Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution2.408 Å
Binding residue
(original residue number in PDB)		E33 A50 F56 T57 A58 L97 Y98 W99
Binding residue
(residue number reindexed from 1)		E33 A50 F57 T58 A59 L101 Y102 W103
External links