Structure of PDB 6bzv Chain D Binding Site BS01

Receptor Information

>6bzv Chain D (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLL
IYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPWT
FGGGTKLEIKRADAAPTVSIFPPSSEQLTSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRG

Ligand information

>6bzv Chain J (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LINTNGSWHI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bzv Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors.
Resolution	2.654 Å
Binding residue (original residue number in PDB)	Y28 F32 N91 N92 E93 D94 W96
Binding residue (residue number reindexed from 1)	Y31 F35 N94 N95 E96 D97 W99

External links

PDB	RCSB:6bzv, PDBe:6bzv, PDBj:6bzv
PDBsum	6bzv
PubMed	29954862

[Back to BioLiP]