Structure of PDB 6bba Chain D Binding Site BS01

Receptor Information
>6bba Chain D (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFL
QSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGS
LLLAAGTPGMRHSLPNSRIMIHQPSATDIAIQAEEIMKLKKQLYNIYAKH
TKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bba Acyldepsipeptide Analogs Dysregulate Human Mitochondrial ClpP Protease Activity and Cause Apoptotic Cell Death.
Resolution2.796 Å
Binding residue
(original residue number in PDB)		R121 L122 I127 H159 Y161 W189 L213
Binding residue
(residue number reindexed from 1)		R22 L23 I28 H60 Y62 W90 L114
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bba, PDBe:6bba, PDBj:6bba
PDBsum6bba
PubMed30126533
UniProtQ16740|CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial (Gene Name=CLPP)

[Back to BioLiP]