Structure of PDB 6b0o Chain D Binding Site BS01

Receptor Information
>6b0o Chain D (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQL
KRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQK
KFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0o Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.552 Å
Binding residue
(original residue number in PDB)		R362 R366 Q369 R372 H373 R376 R390 S393 R394 H397 H401 T404 R424 E427 R430
Binding residue
(residue number reindexed from 1)		R42 R46 Q49 R52 H53 R56 R70 S73 R74 H77 H81 T84 R104 E107 R110
Binding affinityPDBbind-CN: Kd=45nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0o, PDBe:6b0o, PDBj:6b0o
PDBsum6b0o
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]