Structure of PDB 6axl Chain D Binding Site BS01

Receptor Information
>6axl Chain D (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMQLVESGGGVVQPGRSLRLSCTASGFTFSTYAMHWVRQSPGQGLQWVAV
ISYHSTNKYYEDSVRGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDG
YSSSFFDFWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEP
Ligand information
>6axl Chain G (length=12) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6axl Structural basis for antibody recognition of the NANP repeats in Plasmodium falciparum circumsporozoite protein.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A33 S52 Y52A N56 Y97 S98 S99 S100 F100A
Binding residue
(residue number reindexed from 1)		A33 S52 Y53 N57 Y101 S102 S103 S104 F105
External links