Structure of PDB 6axj Chain D Binding Site BS01

Receptor Information
>6axj Chain D (length=142) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDI
SYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEAN
EKVLNFYHRLRLHPYAEVSSVYFDEIVFNEPNEEFFKILMSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6axj Yaf9 subunit of the NuA4 and SWR1 complexes targets histone H3K27ac through its YEATS domain.
Resolution2.379 Å
Binding residue
(original residue number in PDB)		H67 T69 Y70 G88 W89 G90 E91 F92 H118
Binding residue
(residue number reindexed from 1)		H62 T64 Y65 G83 W84 G85 E86 F87 H113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6axj, PDBe:6axj, PDBj:6axj
PDBsum6axj
PubMed29145630
UniProtP53930|AF9_YEAST Protein AF-9 homolog (Gene Name=YAF9)

[Back to BioLiP]