Structure of PDB 6atf Chain D Binding Site BS01

Receptor Information

>6atf Chain D (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>6atf Chain F (length=13) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GVYATRSSAVRLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6atf Molecular basis for increased susceptibility of Indigenous North Americans to seropositive rheumatoid arthritis.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Q9 E11 I31 A52 S53 F54 N62 V65 N69 I72 M73
Binding residue (residue number reindexed from 1)	Q7 E9 I29 A50 S51 F52 N60 V63 N67 I70 M71

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6atf, PDBe:6atf, PDBj:6atf
PDBsum	6atf
PubMed	28801345
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]