Structure of PDB 6aso Chain D Binding Site BS01

Receptor Information
>6aso Chain D (length=59) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTIYIRGTF
IKFIKLQDN
Ligand information
>6aso Chain I (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caauuugaaacaauacagagaugaucagcgguuccccugcauaaggggaa
ccguuuuacaaagaguuuuu
...<<<<...................<<<<<<<<<<<<.....>>>>>>>
>>>>>...>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6aso Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		W35 N37 R72 T74
Binding residue
(residue number reindexed from 1)		W34 N36 R47 T49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006396 RNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6aso, PDBe:6aso, PDBj:6aso
PDBsum6aso
PubMed29717126
UniProtP40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 (Gene Name=LSM4)

[Back to BioLiP]