Structure of PDB 5zyt Chain D Binding Site BS01

Receptor Information
>5zyt Chain D (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPQNWFPIFNPERPLKIPLQRNVIPSVTRVLQQTMTKQQVFLLERWKQRM
ILELGEDGFKEYTSNVFLQGKRFHEALESILSPQENLLKSGYIESVQHIL
KDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQ
STFDNPLQVVAYMGAMNHDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAEL
CSQYWTKWLLRLEEYTEKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zyt Structural insights into DNA degradation by human mitochondrial nuclease MGME1
Resolution2.702 Å
Binding residue
(original residue number in PDB)		L125 E150 T169 F173
Binding residue
(residue number reindexed from 1)		L19 E44 T63 F67
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008297 single-stranded DNA exodeoxyribonuclease activity
GO:0045145 single-stranded DNA 5'-3' DNA exonuclease activity
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0006264 mitochondrial DNA replication
GO:0006281 DNA repair
GO:0043504 mitochondrial DNA repair
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zyt, PDBe:5zyt, PDBj:5zyt
PDBsum5zyt
PubMed30247721
UniProtQ9BQP7|MGME1_HUMAN Mitochondrial genome maintenance exonuclease 1 (Gene Name=MGME1)

[Back to BioLiP]