Structure of PDB 5zu1 Chain D Binding Site BS01

Receptor Information
>5zu1 Chain D (length=47) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEQRILKFLGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zu1 Sequence preference and structural heterogeneity of BZ junctions.
Resolution3.009 Å
Binding residue
(original residue number in PDB)		K170 N173 Y177 T191 P192 P193
Binding residue
(residue number reindexed from 1)		K19 N22 Y26 T40 P41 P42
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:5zu1, PDBe:5zu1, PDBj:5zu1
PDBsum5zu1
PubMed30184200
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]