Structure of PDB 5zia Chain D Binding Site BS01

Receptor Information
>5zia Chain D (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCTASGYTFTGYYLHWVRQAPGQGLEWMGWV
NPRSGGTSYPPKFQGRVTMTRDTSINTAYMDLTWLTSDDTAVYYCAVGRI
PDVTAFDIWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKRVGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zia Structural Basis for Recognition of a Unique Epitope by a Human Anti-tau Antibody.
Resolution2.603 Å
Binding residue
(original residue number in PDB)
G31 Y32 Y33 H35 W50 N52 R53 G95 I97 P98 D99 T100A
Binding residue
(residue number reindexed from 1)
G30 Y31 Y32 H34 W49 N51 R53 G98 I100 P101 D102 T104
External links