Structure of PDB 5zfv Chain D Binding Site BS01

Receptor Information
>5zfv Chain D (length=215) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSL
NQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERR
VAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLA
VVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLL
LQSRDLDLEASAAAH
Ligand information
>5zfv Chain F (length=22) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NVTPFIDVMLVLLIIFMVAAPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zfv Hexameric and pentameric complexes of the ExbBD energizer in the Ton system.
Resolution7.1 Å
Binding residue
(original residue number in PDB)
L145 L167
Binding residue
(residue number reindexed from 1)
L127 L149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0022857 transmembrane transporter activity
GO:0031992 energy transducer activity
GO:0042802 identical protein binding
Biological Process
GO:0006879 intracellular iron ion homeostasis
GO:0015031 protein transport
GO:0015889 cobalamin transport
GO:0017038 protein import
GO:0030003 intracellular monoatomic cation homeostasis
GO:0042928 ferrichrome import into cell
GO:0043213 bacteriocin transport
GO:0050821 protein stabilization
GO:0055085 transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0009279 cell outer membrane
GO:0016020 membrane
GO:0098797 plasma membrane protein complex
GO:1902495 transmembrane transporter complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5zfv, PDBe:5zfv, PDBj:5zfv
PDBsum5zfv
PubMed29661272
UniProtP0ABU7|EXBB_ECOLI Biopolymer transport protein ExbB (Gene Name=exbB)

[Back to BioLiP]