Structure of PDB 5ymv Chain D Binding Site BS01

Receptor Information
>5ymv Chain D (length=271) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELHTLRYIQTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRYVPRTEW
IAAKADQQYWDGQTQIGQGNEQIDRENLGILQRRYNQTGGSHTVQWMYGC
DILEGGPIRGYYQMAYDGRDFTAFDKGTMTFTAAVPEAVPTKRKWEEESE
PERWKNYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSC
RAHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIDAQPGD
GDKYQCRVEHASLPQPGLYSW
Ligand information
>5ymv Chain F (length=9) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVKGVGTMV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ymv An Invariant Arginine in Common with MHC Class II Allows Extension at the C-Terminal End of Peptides Bound to Chicken MHC Class I.
Resolution2.197 Å
Binding residue
(original residue number in PDB)		Y7 Q9 Q62 I65 N69 I72 N76 I79 L80 R83 W95 Y97 Y111 M113 P139 T140 K143 W144 R152 W153 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y8 Q10 Q63 I66 N70 I73 N77 I80 L81 R84 W96 Y98 Y112 M114 P140 T141 K144 W145 R153 W154 Y157 W165 Y169
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ymv, PDBe:5ymv, PDBj:5ymv
PDBsum5ymv
PubMed30341185
UniProtP15979|HA1F_CHICK Class I histocompatibility antigen, F10 alpha chain

[Back to BioLiP]