Structure of PDB 5yj3 Chain D Binding Site BS01

Receptor Information
>5yj3 Chain D (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHME
IHDRVENYNPRQRKLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yj3 The 11th C2H2 zinc finger and an adjacent C-terminal arm are responsible for TZAP recognition of telomeric DNA.
Resolution2.845 Å
Binding residue
(original residue number in PDB)		R594 R611 K612 R614
Binding residue
(residue number reindexed from 1)		R46 R63 K64 R66
Binding affinityPDBbind-CN: Kd=0.17uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yj3, PDBe:5yj3, PDBj:5yj3
PDBsum5yj3
PubMed29134956
UniProtP10074|TZAP_HUMAN Telomere zinc finger-associated protein (Gene Name=ZBTB48)

[Back to BioLiP]